Recombinant Human RBMY1A1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P0DJD3

Gene Name: RBMY1A1

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Phe11

End Site: Thr210

Coverage: 0.42

Isoelectric Point: 12

Core Sequence: FIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGWLPSHEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRRENYGVPPRRATISSWRNDRMST

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 62%, Pig - 68%, Cynomolgus monkey - 87%

Alternative gene names: RBM1; RBM2; YRRM1; YRRM2

Alternative protein names: RNA-binding motif protein; Y chromosome; family 1 member A1; RNA-binding motif protein 1; RNA-binding motif protein 2; Y chromosome RNA recognition motif 1; hRBMY

Protein name: RNA binding motif protein Y-linked family 1 member A1

Full length: 496 amino acids

Entry name: RBY1A_HUMAN

• SKU: ASBPP-3026-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3026-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 5940