Recombinant Human RBMY1B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A6NDE4

Gene Name: RBMY1B

Expression System: Escherichia coli

Molecular Weight: 24 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Phe11

End Site: Thr210

Coverage: 0.42

Isoelectric Point: 11.5

Core Sequence: FIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGWLPSQEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRRENYGVPPRRATISSWRNDRMST

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Rat - 62%, Pig - 68%, Cynomolgus monkey - 86%

Alternative gene names: /

Alternative protein names: RNA-binding motif protein; Y chromosome; family 1 member B

Protein name: RNA binding motif protein Y-linked family 1 member B

Full length: 496 amino acids

Entry name: RBY1B_HUMAN

• SKU: ASBPP-3027-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3027-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 378948