Recombinant Human RBMY1C Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P0DJD4

Gene Name: RBMY1C

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 63%

Start Site: Phe11

End Site: Ile200

Coverage: 0.40

Isoelectric Point: 11.5

Core Sequence: FIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQAQKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGWLPSHEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRRENYGVPPRRATI

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Rat - 63%, Pig - 69%, Cynomolgus monkey - 86%

Alternative gene names: /

Alternative protein names: RNA-binding motif protein; Y chromosome; family 1 member C

Protein name: RNA binding motif protein Y-linked family 1 member C

Full length: 496 amino acids

Entry name: RBY1C_HUMAN

• SKU: ASBPP-3028-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3028-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 5942