Recombinant Human RBMY1D Protein

Recombinant Human RBMY1D Protein
SKU
ASBPP-3029-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P0C7P1

Gene Name: RBMY1D

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 64%

Start Site: Phe11

End Site: Asn190

Coverage: 0.39

Isoelectric Point: 11.5

Core Sequence: FIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGWLPSQEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 64%, Rat - 64%, Pig - 69%, Cynomolgus monkey - 86%

Alternative gene names: /

Alternative protein names: RNA-binding motif protein; Y chromosome; family 1 member D

Protein name: RNA binding motif protein Y-linked family 1 member D

Full length: 496 amino acids

Entry name: RBY1D_HUMAN
More Information
SKU ASBPP-3029-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3029-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 378949
Product information (PDF)
×
MSDS (PDF)
×