Recombinant Human RBP2 Protein

Recombinant Human RBP2 Protein
SKU
ASBPP-3875-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P50120

Gene Name: RBP2

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Met1

End Site: Lys134

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 90%, Pig - 90%, Cynomolgus monkey - 97%

Alternative gene names: CRBP2

Alternative protein names: Retinol-binding protein 2; Cellular retinol-binding protein II; CRBP-II

Protein name: retinol binding protein 2

Full length: 134 amino acids

Entry name: RET2_HUMAN
More Information
SKU ASBPP-3875-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3875-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 5948
Product information (PDF)
×
MSDS (PDF)
×