Recombinant Human RETN Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HD89

Gene Name: RETN

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 58%

Start Site: Ser17

End Site: Pro108

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: SSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 58%, Rat - 49%, Pig - 78%, Cynomolgus monkey - 90%

Alternative gene names: FIZZ3; HXCP1; RSTN

Alternative protein names: Resistin; Adipose tissue-specific secretory factor; ADSF; C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; Cysteine-rich secreted protein A12-alpha-like 2; Cysteine-rich secreted protein FIZZ3

Protein name: resistin

Full length: 108 amino acids

Entry name: RETN_HUMAN

• SKU: ASBPP-3535-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3535-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 56729