Recombinant Human RFX8 Protein

Recombinant Human RFX8 Protein
SKU
ASBPP-3251-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZV50

Gene Name: RFX8

Expression System: Escherichia coli

Molecular Weight: 32 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 66%

Start Site: Ala321

End Site: Arg580

Coverage: 0.47

Isoelectric Point: 5

Core Sequence: AIINQGTLATSKKALASDRSGADELENNPEMKCLRNLISLLGTSTDLRVFLSCLSSHLQAFVFQTSRSKEEFTKLAASFQLRWNLLLTAVSKAMTLCHRDSFGSWHLFHLLLLEYMIHILQSCLEEEEEEEDMGTVKEMLPDDPTLGQPDQALFHSLNSSLSQACASPSMEPLGVMPTHMGQGRYPVGVSNMVLRILGFLVDTAMGNKLIQVLLEDETTESAVKLSLPMGQEALITLKDGQQFVIQISDVPQSSEDIYFR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 66%, Pig - 69%, Cynomolgus monkey - 91%

Alternative gene names: /

Alternative protein names: DNA-binding protein RFX8; Regulatory factor X 8

Protein name: regulatory factor X8

Full length: 586 amino acids

Entry name: RFX8_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3251-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3251-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 731220
Product information (PDF)
×
MSDS (PDF)
×