Recombinant Human RGS18 Protein

Recombinant Human RGS18 Protein
SKU
ASBPP-3995-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NS28

Gene Name: RGS18

Expression System: Escherichia coli

Molecular Weight: 28.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Met1

End Site: Leu235

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIWL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 82%, Pig - 85%, Cynomolgus monkey - 98%

Alternative gene names: RGS13

Alternative protein names: Regulator of G-protein signaling 18; RGS18

Protein name: regulator of G protein signaling 18

Full length: 235 amino acids

Entry name: RGS18_HUMAN
More Information
SKU ASBPP-3995-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3995-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 64407
Product information (PDF)
×
MSDS (PDF)
×