Recombinant Human RHOA Protein

Recombinant Human RHOA Protein
SKU
ASBPP-4101-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P61586

Gene Name: RHOA

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Met1

End Site: Cys190

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: ARH12; ARHA; RHO12

Alternative protein names: Transforming protein RhoA; Rho cDNA clone 12; h12

Protein name: ras homolog family member A

Full length: 193 amino acids

Entry name: RHOA_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4101-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4101-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 387
Product information (PDF)
×
MSDS (PDF)
×