Recombinant Human RIC1 Protein

Recombinant Human RIC1 Protein
SKU
ASBPP-3019-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q4ADV7

Gene Name: RIC1

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Asp1321

End Site: Cys1420

Coverage: 0.07

Isoelectric Point: 5

Core Sequence: DRWASTDCPGYKPFLNIIKPQLQKLSEITEEQVQPDAFQPITMGKTPEQTSPRAEESRGSSSHGSIPQGEVGSSNMVSRKEEDTAQAEEEEPFQDGTYDC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 85%, Cynomolgus monkey - 96%

Alternative gene names: CIP150; KIAA1432

Alternative protein names: Guanine nucleotide exchange factor subunit RIC1; Connexin-43-interacting protein of 150 kDa; Protein RIC1 homolog; RAB6A-GEF complex partner protein 1

Protein name: RIC1 homolog, RAB6A GEF complex partner 1

Full length: 1423 amino acids

Entry name: RIC1_HUMAN
More Information
SKU ASBPP-3019-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3019-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 57589
Product information (PDF)
×
MSDS (PDF)
×