Recombinant Human RIPPLY2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5TAB7

Gene Name: RIPPLY2

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Thr51

End Site: Glu120

Coverage: 0.65

Isoelectric Point: 5

Core Sequence: TPNHAAEAMPDGPGMTAASGKLYQFRHPVRLFWPKSKCYDYLYQEAEALLKNFPIQATISFYEDSDSEDE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Pig - 81%, Cynomolgus monkey - 98%

Alternative gene names: C6orf159

Alternative protein names: Protein ripply2

Protein name: ripply transcriptional repressor 2

Full length: 128 amino acids

Entry name: RIPP2_HUMAN

• SKU: ASBPP-10358-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10358-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 134701