Recombinant Human RNF165 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZSG1

Gene Name: ARK2C

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: His231

End Site: Met300

Coverage: 0.24

Isoelectric Point: 6.5

Core Sequence: HTSAVRESYEELLQLEDRLGNVTRGAVQNTIERFTFPHKYKKRRPQDGKGKKDEGEESDTDEKCTICLSM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%

Alternative gene names: RNF165

Alternative protein names: E3 ubiquitin-protein ligase ARK2C; RING finger protein 165; RNF165

Protein name: arkadia (RNF111) C-terminal like ring finger ubiquitin ligase 2C

Full length: 346 amino acids

Entry name: ARK2C_HUMAN

Product panel: E3 Ligase,Enzyme

• SKU: ASBPP-3320-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3320-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 494470