Recombinant Human RNF38 Protein

Recombinant Human RNF38 Protein
SKU
ASBPP-10491-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9H0F5

Gene Name: RNF38

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Thr41

End Site: Gln190

Coverage: 0.29

Isoelectric Point: 10.5

Core Sequence: TTVQEDAHFKAFFQSEDSPSPKRQRLSHSVFDYTSASPAPSPPMRPWEMTSNRQPPSVRPSQHHFSGERCNTPARNRRSPPVRRQRGRRDRLSRHNSISQDENYHHLPYAQQQAIEEPRAFHPPNVSPRLLHPAAHPPQQNAVMVDIHDQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: E3 ubiquitin-protein ligase RNF38; RING finger protein 38; RING-type E3 ubiquitin transferase RNF38

Protein name: ring finger protein 38

Full length: 515 amino acids

Entry name: RNF38_HUMAN

Product panel: E3 Ligase,Enzyme
More Information
SKU ASBPP-10491-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10491-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 152006
Product information (PDF)
×
MSDS (PDF)
×