Recombinant Human RPS13 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P62277

Gene Name: RPS13

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ala61

End Site: Lys140

Coverage: 0.62

Isoelectric Point: 11

Core Sequence: AQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRKHLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Small ribosomal subunit protein uS15; 40S ribosomal protein S13

Protein name: ribosomal protein S13

Full length: 151 amino acids

Entry name: RS13_HUMAN

• SKU: ASBPP-335-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-335-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6207