Recombinant Human RPS20 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P60866

Gene Name: RPS20

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Val11

End Site: Asp90

Coverage: 0.75

Isoelectric Point: 11

Core Sequence: VEPEVAIHRIRITLTSRNVKSLEKVCADLIRGAKEKNLKVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRLID

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Small ribosomal subunit protein uS10; 40S ribosomal protein S20

Protein name: ribosomal protein S20

Full length: 119 amino acids

Entry name: RS20_HUMAN

• SKU: ASBPP-327-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-327-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 6224