Recombinant Human RRM1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P23921

Gene Name: RRM1

Expression System: Escherichia coli

Molecular Weight: 29.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Gly551

End Site: Cys790

Coverage: 0.31

Isoelectric Point: 7

Core Sequence: GPYETYEGSPVSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCSLENRDECLMC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Pig - 98%, Cynomolgus monkey - 98%

Alternative gene names: RR1

Alternative protein names: Ribonucleoside-diphosphate reductase large subunit; Ribonucleoside-diphosphate reductase subunit M1; Ribonucleotide reductase large subunit

Protein name: ribonucleotide reductase catalytic subunit M1

Full length: 792 amino acids

Entry name: RIR1_HUMAN

Product panel: Enzyme

• SKU: ASBPP-4399-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4399-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 6240