Recombinant Human RSL24D1 Protein

Recombinant Human RSL24D1 Protein
SKU
ASBPP-10461-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UHA3

Gene Name: RSL24D1

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Phe71

End Site: Glu160

Coverage: 0.58

Isoelectric Point: 10

Core Sequence: FEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDME

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: C15orf15; RPL24L

Alternative protein names: Probable ribosome biogenesis protein RLP24; Ribosomal L24 domain-containing protein 1; Ribosomal protein L24-like

Protein name: ribosomal L24 domain containing 1

Full length: 163 amino acids

Entry name: RLP24_HUMAN
More Information
SKU ASBPP-10461-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10461-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 51187
Product information (PDF)
×
MSDS (PDF)
×