Recombinant Human RSPRY1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96DX4

Gene Name: RSPRY1

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Leu31

End Site: Asp140

Coverage: 0.22

Isoelectric Point: 4.5

Core Sequence: LGTGGAATTMGNSCICRDDSGTDDSVDTQQQQAENSAVPTADTRSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPYSMITLHEMAETDEGWLD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 94%, Cynomolgus monkey - 98%

Alternative gene names: KIAA1972

Alternative protein names: RING finger and SPRY domain-containing protein 1

Protein name: ring finger and SPRY domain containing 1

Full length: 576 amino acids

Entry name: RSPRY_HUMAN

Product panel: E3 Ligase

• SKU: ASBPP-3042-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3042-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 89970