Recombinant Human RTRAF Protein

Recombinant Human RTRAF Protein
SKU
ASBPP-438-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y224

Gene Name: RTRAF

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Phe71

End Site: Leu140

Coverage: 0.34

Isoelectric Point: 5.5

Core Sequence: FKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: C14orf166

Alternative protein names: RNA transcription; translation and transport factor protein; CLE7 homolog; CLE; hCLE

Protein name: RNA transcription, translation and transport factor

Full length: 244 amino acids

Entry name: RTRAF_HUMAN
More Information
SKU ASBPP-438-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-438-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 51637
Product information (PDF)
×
MSDS (PDF)
×