Recombinant Human RYR1 Protein

Recombinant Human RYR1 Protein
SKU
ASBPP-4243-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P21817

Gene Name: RYR1

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Pro1361

End Site: Asn1570

Coverage: 0.04

Isoelectric Point: 7

Core Sequence: PQAGGEAQPARAENEKDATTEKNKKRGFLFKAKKVAMMTQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFAGQEPSCVWAGWVTPDYHQHDMSFDLSKVRVVTVTMGDEQGNVHSSLKCSNCYMVWGGDFVSPGQQGRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELGKQKN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 95%, Pig - 94%, Cynomolgus monkey - 52%

Alternative gene names: RYDR

Alternative protein names: Ryanodine receptor 1; RYR-1; RyR1; Skeletal muscle calcium release channel; Skeletal muscle ryanodine receptor; Skeletal muscle-type ryanodine receptor; Type 1 ryanodine receptor

Protein name: ryanodine receptor 1

Full length: 5038 amino acids

Entry name: RYR1_HUMAN
More Information
SKU ASBPP-4243-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4243-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6261
Product information (PDF)
×
MSDS (PDF)
×