Recombinant Human SAE1 Protein

Recombinant Human SAE1 Protein
SKU
ASBPP-2879-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UBE0

Gene Name: SAE1

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Glu171

End Site: Asp290

Coverage: 0.37

Isoelectric Point: 5.5

Core Sequence: EHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPED

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 88%, Pig - 95%, Cynomolgus monkey - 98%

Alternative gene names: AOS1; SUA1; UBLE1A

Alternative protein names: SUMO-activating enzyme subunit 1; Ubiquitin-like 1-activating enzyme E1A) [Cleaved into: SUMO-activating enzyme subunit 1; N-terminally processed]

Protein name: SUMO1 activating enzyme subunit 1

Full length: 346 amino acids

Entry name: SAE1_HUMAN

Product panel: Autoimmune Disease
More Information
SKU ASBPP-2879-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2879-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10055
Product information (PDF)
×
MSDS (PDF)
×