Recombinant Human SAP30L Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HAJ7

Gene Name: SAP30L

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Arg11

End Site: Arg120

Coverage: 0.66

Isoelectric Point: 8.5

Core Sequence: REGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: NS4ATP2

Alternative protein names: Histone deacetylase complex subunit SAP30L; HCV non-structural protein 4A-transactivated protein 2; Sin3 corepressor complex subunit SAP30L; Sin3-associated protein p30-like

Protein name: SAP30 like

Full length: 183 amino acids

Entry name: SP30L_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-10447-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10447-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 79685