Recombinant Human SCAF8 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UPN6

Gene Name: SCAF8

Expression System: Escherichia coli

Molecular Weight: 29 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Thr151

End Site: Glu390

Coverage: 0.20

Isoelectric Point: 4.5

Core Sequence: TTAMSNTPGTPVTPVTPANVVQGLPDPWVSQITNTDTLAAVAQILQSPQGQQLQQLIQTLQIQQQKPQPSILQALDAGLVVQLQALTAQLTAAAAAANTLTPLEQGVSFNKKLMDRFDFGEDSEHSEEPKKEIPASQLSHVSESVNNSIFHQIAEQLQQQNLEHLRQQLLEQQQPQKATPQDSQEGTFGSEHSASPSQGSSQQHFLEPEVNLDDSIDIQQQDMDIDEGQDGVEEEVFEQE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: CCAP7; KIAA1116; RBM16

Alternative protein names: SR-related and CTD-associated factor 8; CDC5L complex-associated protein 7; RNA-binding motif protein 16

Protein name: SR-related CTD associated factor 8

Full length: 1271 amino acids

Entry name: SCAF8_HUMAN

• SKU: ASBPP-2943-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2943-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 22828