Recombinant Human SCGB3A2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96PL1

Gene Name: SCGB3A2

Expression System: Escherichia coli

Molecular Weight: 50 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Phe22

End Site: Val93

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Pig - 88%, Cynomolgus monkey - 88%

Alternative gene names: PNSP1; UGRP1

Alternative protein names: Secretoglobin family 3A member 2; Pneumo secretory protein 1; PnSP-1; Uteroglobin-related protein 1

Protein name: secretoglobin family 3A member 2

Full length: 93 amino acids

Entry name: SG3A2_HUMAN

Product panel: Cytokines

• SKU: ASBPP-3051-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3051-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 117156