Recombinant Human SCGB3A2 Protein

Recombinant Human SCGB3A2 Protein
SKU
ASBPP-3052-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96PL1

Gene Name: SCGB3A2

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Phe22

End Site: Val93

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: FLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Pig - 88%, Cynomolgus monkey - 88%

Alternative gene names: PNSP1; UGRP1

Alternative protein names: Secretoglobin family 3A member 2; Pneumo secretory protein 1; PnSP-1; Uteroglobin-related protein 1

Protein name: secretoglobin family 3A member 2

Full length: 93 amino acids

Entry name: SG3A2_HUMAN

Product panel: Cytokines
More Information
SKU ASBPP-3052-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3052-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 117156
Product information (PDF)
×
MSDS (PDF)
×