Recombinant Human SCN1A Protein

Recombinant Human SCN1A Protein
SKU
ASBPP-4420-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P35498

Gene Name: SCN1A

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Leu1051

End Site: Glu1170

Coverage: 0.06

Isoelectric Point: 4

Core Sequence: LDDLNNKKDSCMSNHTAEIGKDLDYLKDVNGTTSGIGTGSSVEKYIIDESDYMSFINNPSLTVTVPIAVGESDFENLNTEDFSSESDLEESKEKLNESSSSSEGSTVDIGAPVEEQPVVE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 97%, Cynomolgus monkey - 99%

Alternative gene names: NAC1; SCN1

Alternative protein names: Sodium channel protein type 1 subunit alpha; Sodium channel protein brain I subunit alpha; Sodium channel protein type I subunit alpha; Voltage-gated sodium channel subunit alpha Nav1.1

Protein name: sodium voltage-gated channel alpha subunit 1

Full length: 2009 amino acids

Entry name: SCN1A_HUMAN
More Information
SKU ASBPP-4420-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4420-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 6323
Product information (PDF)
×
MSDS (PDF)
×