Recombinant Human SCNM1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BWG6

Gene Name: SCNM1

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Ala61

End Site: Asp230

Coverage: 0.74

Isoelectric Point: 9.5

Core Sequence: AHRAGKKHLSSLQLFYGKKQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQSALHRAPHYNSCCRRKYRPEAPGPSVSLSPMPPSEVKLQSGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYLTLRSSGWIPDGRGRWVKDENVEFDSDEEEPPDLPLD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Pig - 85%

Alternative gene names: /

Alternative protein names: Sodium channel modifier 1

Protein name: sodium channel modifier 1

Full length: 230 amino acids

Entry name: SCNM1_HUMAN

• SKU: ASBPP-3291-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3291-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 79005