Recombinant Human SEMA3A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q14563

Gene Name: SEMA3A

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Glu671

End Site: Arg760

Coverage: 0.12

Isoelectric Point: 10.5

Core Sequence: EHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHLQENKKGRNRR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 94%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: SEMAD

Alternative protein names: Semaphorin-3A; Semaphorin III; Sema III

Protein name: semaphorin 3A

Full length: 771 amino acids

Entry name: SEM3A_HUMAN

• SKU: ASBPP-3050-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3050-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10371