Recombinant Human SERPINA9 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86WD7

Gene Name: SERPINA9

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Phe331

End Site: Lys410

Coverage: 0.23

Isoelectric Point: 9

Core Sequence: FDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 43%

Alternative gene names: GCET1; SERPINA11

Alternative protein names: Serpin A9; Centerin; Germinal center B-cell-expressed transcript 1 protein

Protein name: serpin family A member 9

Full length: 417 amino acids

Entry name: SPA9_HUMAN

• SKU: ASBPP-3317-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3317-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 327657