Recombinant Human SERPINB4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P48594

Gene Name: SERPINB4

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 63%

Start Site: Val131

End Site: Val210

Coverage: 0.21

Isoelectric Point: 8

Core Sequence: VESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAIYFKGQWENKFKKENTKEEKFWPNKNTYKSV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 63%, Rat - 55%, Pig - 71%, Cynomolgus monkey - 92%

Alternative gene names: PI11; SCCA2

Alternative protein names: Serpin B4; Leupin; Peptidase inhibitor 11; PI-11; Squamous cell carcinoma antigen 2; SCCA-2

Protein name: serpin family B member 4

Full length: 390 amino acids

Entry name: SPB4_HUMAN

• SKU: ASBPP-301-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-301-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 6318