Recombinant Human SET Protein

Recombinant Human SET Protein
SKU
ASBPP-3962-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q01105

Gene Name: SET

Expression System: Escherichia coli

Molecular Weight: 34.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Met1

End Site: Asp290

Coverage: 1.00

Isoelectric Point: 4

Core Sequence: MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 94%

Alternative gene names: /

Alternative protein names: Protein SET; HLA-DR-associated protein II; Inhibitor of granzyme A-activated DNase; IGAAD; PHAPII; Phosphatase 2A inhibitor I2PP2A; I-2PP2A; Template-activating factor I; TAF-I

Protein name: SET nuclear proto-oncogene

Full length: 290 amino acids

Entry name: SET_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3962-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3962-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 6418
Product information (PDF)
×
MSDS (PDF)
×