Note: Dry Ice fees will be extra-charged
Uniprot: Q8WTS6
Gene Name: SETD7
Expression System: Escherichia coli
Molecular Weight: 13.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 98%
Start Site: Ala11
End Site: Tyr110
Coverage: 0.30
Isoelectric Point: 4
Core Sequence: AVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLEGYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQY
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 31%, Pig - 99%
Alternative gene names: KIAA1717; KMT7; SET7; SET9
Alternative protein names: Histone-lysine N-methyltransferase SETD7; Histone H3-K4 methyltransferase SETD7; H3-K4-HMTase SETD7; Lysine N-methyltransferase 7; SET domain-containing protein 7; SET7/9
Protein name: SET domain containing 7, histone lysine methyltransferase
Full length: 366 amino acids
Entry name: SETD7_HUMAN
Product panel: DNA binding & Chromatin,Enzyme
English
Deutsch
