Recombinant Human SF3A2 Protein

Recombinant Human SF3A2 Protein
SKU
ASBPP-10391-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q15428

Gene Name: SF3A2

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Lys91

End Site: Phe210

Coverage: 0.27

Isoelectric Point: 10

Core Sequence: KEAPAQPAPEKVKVEVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: SAP62

Alternative protein names: Splicing factor 3A subunit 2; SF3a66; Spliceosome-associated protein 62; SAP 62

Protein name: splicing factor 3a subunit 2

Full length: 464 amino acids

Entry name: SF3A2_HUMAN
More Information
SKU ASBPP-10391-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10391-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 8175
Product information (PDF)
×
MSDS (PDF)
×