Recombinant Human SGMS1 Protein

Recombinant Human SGMS1 Protein
SKU
ASBPP-3274-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q86VZ5

Gene Name: SGMS1

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Lys11

End Site: Met130

Coverage: 0.32

Isoelectric Point: 6.5

Core Sequence: KVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRLLDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPMPELERSQYPM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 93%, Cynomolgus monkey - 100%

Alternative gene names: MOB; SMS1; TMEM23

Alternative protein names: Phosphatidylcholine:ceramide cholinephosphotransferase 1; Medulla oblongata-derived protein; Protein Mob; Sphingomyelin synthase 1; Transmembrane protein 23

Protein name: sphingomyelin synthase 1

Full length: 413 amino acids

Entry name: SMS1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3274-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3274-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 259230
Product information (PDF)
×
MSDS (PDF)
×