Recombinant Human SHANK3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9BYB0

Gene Name: SHANK3

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Asp671

End Site: Thr750

Coverage: 0.04

Isoelectric Point: 10.5

Core Sequence: DGARRRAPPPPKRAPSTTLTLRSKSMTAELEELASIRRRKGEKLDEMLAAAAEPTLRPDIADADSRAATVKQRPTSRRIT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 88%, Cynomolgus monkey - 50%

Alternative gene names: KIAA1650; PROSAP2; PSAP2

Alternative protein names: SH3 and multiple ankyrin repeat domains protein 3; Shank3; Proline-rich synapse-associated protein 2; ProSAP2

Protein name: SH3 and multiple ankyrin repeat domains 3

Full length: 1731 amino acids

Entry name: SHAN3_HUMAN

• SKU: ASBPP-4309-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4309-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 85358