Recombinant Human SIGLEC8 Protein

Recombinant Human SIGLEC8 Protein
SKU
ASBPP-410-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NYZ4

Gene Name: SIGLEC8

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 53%

Start Site: Ser421

End Site: His490

Coverage: 0.17

Isoelectric Point: 6.5

Core Sequence: SWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRETAETQACLRNH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 53%, Pig - 58%, Cynomolgus monkey - 66%

Alternative gene names: SAF2

Alternative protein names: Sialic acid-binding Ig-like lectin 8; Siglec-8; Sialoadhesin family member 2; SAF-2

Protein name: sialic acid binding Ig like lectin 8

Full length: 499 amino acids

Entry name: SIGL8_HUMAN
More Information
SKU ASBPP-410-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-410-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 27181
Product information (PDF)
×
MSDS (PDF)
×