Recombinant Human SIK3 Protein

Recombinant Human SIK3 Protein
SKU
ASBPP-3275-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y2K2

Gene Name: SIK3

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 71%

Start Site: Ala561

End Site: Thr670

Coverage: 0.09

Isoelectric Point: 5

Core Sequence: AQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQSSTYKDSNTLHLPTERFSPVRRFSDGAASIQAFKAHLEKMGNNSSIKQLQQECEQLQKMYGGQIDERT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 71%, Pig - 100%, Cynomolgus monkey - 99%

Alternative gene names: KIAA0999; QSK

Alternative protein names: Serine/threonine-protein kinase SIK3; Salt-inducible kinase 3; SIK-3; Serine/threonine-protein kinase QSK

Protein name: SIK family kinase 3

Full length: 1321 amino acids

Entry name: SIK3_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3275-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3275-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 23387
Product information (PDF)
×
MSDS (PDF)
×