Recombinant Human SIRPG Protein

Recombinant Human SIRPG Protein
SKU
ASBPP-3278-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9P1W8

Gene Name: SIRPG

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 61%

Start Site: Glu31

End Site: Val130

Coverage: 0.30

Isoelectric Point: 6.5

Core Sequence: ELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 61%, Rat - 59%, Pig - 66%, Cynomolgus monkey - 95%

Alternative gene names: SIRPB2

Alternative protein names: Signal-regulatory protein gamma; SIRP-gamma; CD172 antigen-like family member B; Signal-regulatory protein beta-2; SIRP-b2; SIRP-beta-2; CD antigen CD172g

Protein name: signal regulatory protein gamma

Full length: 387 amino acids

Entry name: SIRPG_HUMAN

CD Antigen: CD172g

Product panel: CD Antigen
More Information
SKU ASBPP-3278-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3278-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55423
Product information (PDF)
×
MSDS (PDF)
×