Recombinant Human SIRT5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NXA8

Gene Name: SIRT5

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Ala41

End Site: Ala300

Coverage: 0.98

Isoelectric Point: 7.5

Core Sequence: ADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 89%, Pig - 90%, Cynomolgus monkey - 98%

Alternative gene names: SIR2L5

Alternative protein names: NAD-dependent protein deacylase sirtuin-5; mitochondrial; Regulatory protein SIR2 homolog 5; SIR2-like protein 5

Protein name: sirtuin 5

Full length: 310 amino acids

Entry name: SIR5_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3276-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3276-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 23408