Recombinant Human SLC12A8 Protein

Recombinant Human SLC12A8 Protein
SKU
ASBPP-3302-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A0AV02

Gene Name: SLC12A8

Expression System: Escherichia coli

Molecular Weight: 22.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: Ser411

End Site: Thr590

Coverage: 0.26

Isoelectric Point: 6

Core Sequence: SLTPVPEPVLREGAEGLHCSEHLLLEKAPSYGSEGPAQRVLEGTLLEFTKDMDQLLQLTRKLESSQPRQGEGNRTPESQKRKSKKATKQTLQDSFLLDLKSPPSFPVEISDRLPAASWEGQESCWNKQTSKSEGTQPEGTYGEQLVPELCNQSESSGEDFFLKSRLQEQDVWRRSTSFYT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Rat - 58%, Pig - 69%

Alternative gene names: CCC9

Alternative protein names: Solute carrier family 12 member 8; Cation-chloride cotransporter 9

Protein name: solute carrier family 12 member 8

Full length: 714 amino acids

Entry name: S12A8_HUMAN
More Information
SKU ASBPP-3302-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3302-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 84561
Product information (PDF)
×
MSDS (PDF)
×