Recombinant Human SLC13A4 Protein

Recombinant Human SLC13A4 Protein
SKU
ASBPP-3368-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UKG4

Gene Name: SLC13A4

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 29%

Start Site: Thr141

End Site: His260

Coverage: 0.20

Isoelectric Point: 6.5

Core Sequence: TSTTAMVMPIVEAVLQELVSAEDEQLVAGNSNTEEAEPISLDVKNSQPSLELIFVNEESNADLTTLMHNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 29%, Rat - 29%, Pig - 75%, Cynomolgus monkey - 95%

Alternative gene names: SUT1

Alternative protein names: Solute carrier family 13 member 4; Na(+)/sulfate cotransporter SUT-1; NaS2

Protein name: solute carrier family 13 member 4

Full length: 626 amino acids

Entry name: S13A4_HUMAN
More Information
SKU ASBPP-3368-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3368-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 26266
Product information (PDF)
×
MSDS (PDF)
×