Recombinant Human SLC15A1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P46059

Gene Name: SLC15A1

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 75%

Start Site: Lys391

End Site: Phe490

Coverage: 0.16

Isoelectric Point: 8

Core Sequence: KGNEVQIKVLNIGNNTMNISLPGEMVTLGPMSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENGIRF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 75%, Rat - 72%, Pig - 78%, Cynomolgus monkey - 91%

Alternative gene names: PEPT1

Alternative protein names: Solute carrier family 15 member 1; Intestinal H(+)/peptide cotransporter; Oligopeptide transporter; small intestine isoform; Peptide transporter 1

Protein name: solute carrier family 15 member 1

Full length: 708 amino acids

Entry name: S15A1_HUMAN

• SKU: ASBPP-4267-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4267-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 6564