Recombinant Human SLC25A12 Protein

Recombinant Human SLC25A12 Protein
SKU
ASBPP-3803-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O75746

Gene Name: SLC25A12

Expression System: Escherichia coli

Molecular Weight: 33.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Asn51

End Site: Trp320

Coverage: 0.42

Isoelectric Point: 6

Core Sequence: NSNPKIVQLLAGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTIIHHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMVTIRSHMLTPFVEENLVSAAGGSISHQVSFSYFNAFNSLLNNMELVRKIYSTLAGTRKDVEVTKEEFAQSAIRYGQVTPLEIDILYQLADLYNASGRLTLADIERIAPLAEGALPYNLAELQRQQSPGLGRPIW

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 93%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: AGC1; ARALAR1

Alternative protein names: Electrogenic aspartate/glutamate antiporter SLC25A12; mitochondrial; Araceli hiperlarga; Aralar; Aralar1; Mitochondrial aspartate glutamate carrier 1; Solute carrier family 25 member 12

Protein name: solute carrier family 25 member 12

Full length: 678 amino acids

Entry name: S2512_HUMAN
More Information
SKU ASBPP-3803-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3803-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 8604
Product information (PDF)
×
MSDS (PDF)
×