Recombinant Human SLC26A7 Protein

Recombinant Human SLC26A7 Protein
SKU
ASBPP-4282-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8TE54

Gene Name: SLC26A7

Expression System: Escherichia coli

Molecular Weight: 20 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Lys481

End Site: His640

Coverage: 0.25

Isoelectric Point: 5.5

Core Sequence: KNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNMIQKENACNQPLDDISKCEQNTLLNSLSNGNCNEEASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGRSVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Pig - 87%, Cynomolgus monkey - 97%

Alternative gene names: SUT2

Alternative protein names: Anion exchange transporter; Solute carrier family 26 member 7

Protein name: solute carrier family 26 member 7

Full length: 656 amino acids

Entry name: S26A7_HUMAN
More Information
SKU ASBPP-4282-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4282-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 115111
Product information (PDF)
×
MSDS (PDF)
×