Recombinant Human SLC30A10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q6XR72

Gene Name: SLC30A10

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Glu301

End Site: Val480

Coverage: 0.37

Isoelectric Point: 6.5

Core Sequence: ETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQDASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGALPLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 38%, Pig - 79%, Cynomolgus monkey - 97%

Alternative gene names: ZNT10; ZNT8

Alternative protein names: Calcium/manganese antiporter SLC30A10; Solute carrier family 30 member 10; Zinc transporter 10; ZnT-10

Protein name: solute carrier family 30 member 10

Full length: 485 amino acids

Entry name: ZNT10_HUMAN

• SKU: ASBPP-3640-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3640-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 55532