Recombinant Human SLC30A9 Protein

Recombinant Human SLC30A9 Protein
SKU
ASBPP-3467-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6PML9

Gene Name: SLC30A9

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Gly451

End Site: Val560

Coverage: 0.23

Isoelectric Point: 4.5

Core Sequence: GRSIQPEQVQRLTELLENDPSVRAIHDVKATDLGLGKVRFKAEVDFDGRVVTRSYLEKQDFDQMLQEIQEVKTPEELETFMLKHGENIIDTLGAEVDRLEKELKKRNPEV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: C4orf1; HUEL

Alternative protein names: Proton-coupled zinc antiporter SLC30A9; mitochondrial; Human embryonic lung protein; HuEL; Solute carrier family 30 member 9; Zinc transporter 9; ZnT-9

Protein name: solute carrier family 30 member 9

Full length: 568 amino acids

Entry name: ZNT9_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3467-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3467-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10463
Product information (PDF)
×
MSDS (PDF)
×