Recombinant Human SLC4A7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6M7

Gene Name: SLC4A7

Expression System: Escherichia coli

Molecular Weight: 16 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Ala331

End Site: Glu460

Coverage: 0.11

Isoelectric Point: 4.5

Core Sequence: APELLVSPASDDIPTVVIHPPEEDLEAALKGEEQKNEENVDLTPGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMRKIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 89%

Alternative gene names: BT; NBC2; NBC2B; NBC3; NBCn1; SBC2; SLC4A6

Alternative protein names: Sodium bicarbonate cotransporter 3; Electroneutral Na/HCO(3) cotransporter; Sodium bicarbonate cotransporter 2; Sodium bicarbonate cotransporter 2b; Bicarbonate transporter; Solute carrier family 4 member 7

Protein name: solute carrier family 4 member 7

Full length: 1214 amino acids

Entry name: S4A7_HUMAN

• SKU: ASBPP-2997-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2997-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9497