Recombinant Human SLC4A9 Protein

Recombinant Human SLC4A9 Protein
SKU
ASBPP-4226-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96Q91

Gene Name: SLC4A9

Expression System: Escherichia coli

Molecular Weight: 46.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Phe11

End Site: Leu410

Coverage: 0.42

Isoelectric Point: 7

Core Sequence: FEASSAPRNIPSGELDSNPDPGTGPSPDGPSDTESKELGVPKDPLLFIQLNELLGWPQALEWRETGSSSASLLLDMGEMPSITLSTHLHHRWVLFEEKLEVAAGRWSAPHVPTLALPSLQKLRSLLAEGLVLLDCPAQSLLELVEQVTRVESLSPELRGQLQALLLQRPQHYNQTTGTRPCWGSTHPRKASDNEEAPLREQCQNPLRQKLPPGAEAGTVLAGELGFLAQPLGAFVRLRNPVVLGSLTEVSLPSRFFCLLLGPCMLGKGYHEMGRAAAVLLSDPQFQWSVRRASNLHDLLAALDAFLEEVTVLPPGRWDPTARIPPPKCLPSQHKRLPSQQREIRGPAVPRLTSAEDRHRHGPHAHSPELQRTGRLFGGLIQDVRRKVPWYPSDFLDALHL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 72%, Pig - 75%, Cynomolgus monkey - 96%

Alternative gene names: AE4; SBC5

Alternative protein names: Anion exchange protein 4; AE 4; Anion exchanger 4; Sodium bicarbonate cotransporter 5; Solute carrier family 4 member 9

Protein name: solute carrier family 4 member 9

Full length: 983 amino acids

Entry name: B3A4_HUMAN
More Information
SKU ASBPP-4226-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4226-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 83697
Product information (PDF)
×
MSDS (PDF)
×