Recombinant Human SLC6A5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y345

Gene Name: SLC6A5

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Thr61

End Site: Ala190

Coverage: 0.17

Isoelectric Point: 6.5

Core Sequence: TFQSADARACEAERPGVGSCKLSSPRAQAASAALRDLREAQGAQASPPPGSSGPGNALHCKIPFLRGPEGDANVSVGKGTLERNNTPVVGWVNMSQSTVVLATDGITSVLPGSVATVATQEDEQGDENKA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 83%, Pig - 86%, Cynomolgus monkey - 95%

Alternative gene names: GLYT2; NET1

Alternative protein names: Sodium- and chloride-dependent glycine transporter 2; GlyT-2; GlyT2; Solute carrier family 6 member 5

Protein name: solute carrier family 6 member 5

Full length: 797 amino acids

Entry name: SC6A5_HUMAN

• SKU: ASBPP-2957-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2957-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 9152