Recombinant Human SLURP1 Protein

Recombinant Human SLURP1 Protein
SKU
ASBPP-3047-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P55000

Gene Name: SLURP1

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 67%

Start Site: Leu23

End Site: Leu103

Coverage: 1.00

Isoelectric Point: 6

Core Sequence: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 67%, Pig - 69%, Cynomolgus monkey - 88%

Alternative gene names: ARS

Alternative protein names: Secreted Ly-6/uPAR-related protein 1; SLURP-1; ARS component B; ARS(component B)-81/S; Anti-neoplastic urinary protein; ANUP

Protein name: secreted LY6/PLAUR domain containing 1

Full length: 103 amino acids

Entry name: SLUR1_HUMAN
More Information
SKU ASBPP-3047-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3047-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 57152
Product information (PDF)
×
MSDS (PDF)
×